PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G355500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 214aa    MW: 23464.4 Da    PI: 6.3677
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G355500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.38.9e-1073114950
                         CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   9 rkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                         +   NReA r++R++Kka  + Lee+vk+L a N++L  +l+
  Sevir.5G355500.1.p  73 KPLGNREAVRKYREKKKAHAAFLEEEVKKLRATNQQLLRRLQ 114
                         4455*********************************98887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.7E-1561133No hitNo description
SMARTSM003384.1E-1065132IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.72667114IPR004827Basic-leucine zipper domain
CDDcd146864.03E-1168123No hitNo description
SuperFamilySSF579591.5E-769115No hitNo description
PfamPF077161.8E-1173122IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MDNGVDLPIP SHLPLSHPEI SHGLDDFLKS TTACTHTHTC NPPGPAAAMH THTCLHTHTQ  60
VIASGEEQRK PQKPLGNREA VRKYREKKKA HAAFLEEEVK KLRATNQQLL RRLQGHAALE  120
AEVVRLRVLL FDVRGKIDAE IDSFPFQKHS SVDSVICTDP PLCFNTNAEV AARETSSGGP  180
TILDFEIDES GSVSRELDIP EVVNSMDAAA SYF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1849691e-170KF184969.1 Saccharum hybrid cultivar R570 clone BAC 045L22 complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970278.11e-157PREDICTED: uncharacterized protein LOC101760983
RefseqXP_004970277.11e-157PREDICTED: uncharacterized protein LOC101760983
SwissprotQ8GTS25e-52BZP23_ARATH; Basic leucine zipper 23
TrEMBLK3XLX01e-157K3XLX0_SETIT; Uncharacterized protein
STRINGSi002893m1e-156(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38313675
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.12e-40bZIP family protein